PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.C01017.1.p
Common NameLOC105950763, MIMGU_mgv1a026923mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family Trihelix
Protein Properties Length: 605aa    MW: 66842.7 Da    PI: 6.8075
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.C01017.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix95.84.1e-3051135187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW++qe+laL+++r++m+ ++r+++lk+plW+evs+km+e gf+r pk+Ckek+en+ k++k++k+g++ +  ++ +++++fdqlea
  Migut.C01017.1.p  51 RWPRQETLALLKIRSDMDVAFRDASLKGPLWDEVSRKMAELGFQRHPKKCKEKFENVYKYHKRTKDGRSTK--PDGKSYRFFDQLEA 135
                       8********************************************************************85..66678*******85 PP

2trihelix102.53.2e-32416501187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+k ev aLi++r++++ ++ ++  k+plWee+s+ m + g++rs+k+Ckekwen+nk++kk+ke++k+r +e+s+tcpyf+qlea
  Migut.C01017.1.p 416 RWPKAEVEALINLRTRLDLKYMENGPKGPLWEEISAEMGKIGYKRSSKRCKEKWENINKYFKKVKESNKRR-PEDSKTCPYFHQLEA 501
                       8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.3848110IPR001005SANT/Myb domain
PROSITE profilePS500906.49350108IPR017877Myb-like domain
PfamPF138372.1E-1950136No hitNo description
CDDcd122033.57E-2450115No hitNo description
SMARTSM007178.2E-5413475IPR001005SANT/Myb domain
PROSITE profilePS500907.561415473IPR017877Myb-like domain
CDDcd122035.02E-26415480No hitNo description
Gene3DG3DSA:1.10.10.608.2E-5415472IPR009057Homeodomain-like
PfamPF138372.5E-21415502No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MMLGVSGGAA AAEAVEAHES GGASGGSGSS SVPGGAIEES ERSGGGGGGN RWPRQETLAL  60
LKIRSDMDVA FRDASLKGPL WDEVSRKMAE LGFQRHPKKC KEKFENVYKY HKRTKDGRST  120
KPDGKSYRFF DQLEALENTP PNSISFTPPP PPPRPQPPAA MAVAAPANGT PNIVPMPSIS  180
PTPLSIVHPN NTQKTPINNP SSFQPMLSQL PPPLQHPQSN FQPSSHPYNN LPTGQLLNST  240
SSSSSTSSDE DIIQRRRGKK RKWKDYFERL MKDVVHKQEE LQKKFLEALE KRERDRMARD  300
EAWRVQETAR INREHELLLH ERSISAAKDA AVIAFLQKAT HSDDRAPPEN NPPPPQQPPP  360
RRQQPPAMPP PPPAAVAAPA PAAPVQQAGP LVVVPTEQAG PLEVAVIPSG GGSASRWPKA  420
EVEALINLRT RLDLKYMENG PKGPLWEEIS AEMGKIGYKR SSKRCKEKWE NINKYFKKVK  480
ESNKRRPEDS KTCPYFHQLE AIYKERANHS SNNHGPSTFE HESPMLPIMA RPEQQWPLSQ  540
QQLEKHDSVL IMHGHDQDGS ENNEHEEEDD EEEEEEEDEG GGAGGGYEIM VNKQQPSSVA  600
NTAE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1253261QRRRGKKRK
2255261RRGKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012829582.10.0PREDICTED: trihelix transcription factor GT-2-like
TrEMBLA0A022PPW30.0A0A022PPW3_ERYGU; Uncharacterized protein
STRINGSolyc12g056510.1.11e-172(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24022459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-50Trihelix family protein